PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009632036.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NF-YA
Protein Properties Length: 243aa    MW: 27196.5 Da    PI: 9.9753
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009632036.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA93.62.4e-2990146158
       CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                     +ep+YVNaKQy++Il+RRq Rak+  e+k+  ksrkpylheSRh+hA+rR+R  gGrF
  XP_009632036.1  90 EEPMYVNAKQYHGILRRRQLRAKAVLEQKV-VKSRKPYLHESRHRHAMRRARDGGGRF 146
                     69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005218.3E-3388149IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115234.79289149IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.2E-2691146IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006163.5E-2292114IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006163.5E-22123146IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MDPPLLADSD CKRDGKRVEF MPPIMGENLR AANQFELMPP SIAFRSYPYS EVPQYSGGNV  60
AAAFGESTVH QNIERSVHNG RMILPLEVKE EPMYVNAKQY HGILRRRQLR AKAVLEQKVV  120
KSRKPYLHES RHRHAMRRAR DGGGRFLNTK KKIQLTTINN NNNGNTNATP SSKGKGSSAS  180
EVSSMDSYSG HIGSSNSTAH VQGFQFQGIH NTENPQLGCH YQWNLNDNHC NCMQSGASNI  240
QPF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A2e-2090152264NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1130139RHRHAMRRAR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009632036.10.0PREDICTED: nuclear transcription factor Y subunit A-7-like
SwissprotQ945M99e-29NFYA9_ARATH; Nuclear transcription factor Y subunit A-9
TrEMBLM1AEI57e-98M1AEI5_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000210532e-97(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA133921516
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12840.43e-29nuclear factor Y, subunit A1